Active Recombinant Mouse Il13 Protein (111 aa)

• Cat.No.: Il13-038I
• Product Overview: Recombinant Mouse Il13 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 111
• Description: IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 is cross-species reactive.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 as determined by the dose-dependent proliferation of TF-1 cells was < 4.0 ng/mL, corresponding to a specific activity of > 2.5 × 10^5 units/mg.
• Molecular Mass: Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 111 amino acids.
• AA Sequence: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Endotoxin: Less than 1 EU/mg of rmIL-13 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il13 interleukin 13 [ Mus musculus ]
• Official Symbol: Il13
• Synonyms: IL13; interleukin 13; interleukin-13; T-cell activation protein P600; Il-13
• Gene ID: 16163
• mRNA Refseq: NM_008355
• Protein Refseq: NP_032381
• UniProt ID: P20109