Active Recombinant Mouse Il12a Protein
Cat.No. : | Il12a-086M |
Product Overview : | Purified recombinant protein of Mouse interleukin 12a (Il12a), transcript variant 2 without tag was expressed in CHO cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. |
Bio-activity : | Assay #1: ED50 was determined by the stimulation of IFN-gamma production by murine splenocytes co-stimulated with IL-18 is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. Assay #2: Determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is <0.1ng/ml, corresponding to a specific activity of >1 x 10^7 units/mg. |
Molecular Mass : | 75 kDa |
AA Sequence : | p35 Subunit: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA p40 Subunit: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il12a interleukin 12a [ Mus musculus (house mouse) ] |
Official Symbol | Il12a |
Synonyms | Il12a; interleukin 12a; p35; Ll12a; Il-12a; IL-12p35; interleukin-12 subunit alpha; CLMF p35; IL-12 p35 subunit; IL-12 subunit p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; interleukin 12a p35 subunit; interleukin-12 p35 subunit |
Gene ID | 16159 |
mRNA Refseq | NM_008351 |
Protein Refseq | NP_032377 |
UniProt ID | P43431 |
◆ Recombinant Proteins | ||
IL12A-42H | Recombinant Human IL12A, His-tagged | +Inquiry |
IL12A-2229R | Recombinant Rhesus monkey IL12A Protein, His-tagged | +Inquiry |
Il12a-6738M | Recombinant Mouse Il12a Protein (Met1-Ala215), C-His and C-TwinStrep tagged | +Inquiry |
IL12A-75H | Recombinant Human IL12A Protein | +Inquiry |
IL12A-0255H | Recombinant Human IL12A protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il12a Products
Required fields are marked with *
My Review for All Il12a Products
Required fields are marked with *
0
Inquiry Basket