Active Recombinant Mouse Il11 Protein, His-Tagged

• Cat.No.: Il11-01M
• Product Overview: Recombinant mouse Il11 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: IL-11 is a cytokine and first isolated in 1990 from bone marrow-derived fibrocyte-like stromal cells. It was initially thought to be important for hematopoiesis, notably for megakaryocyte maturation, but subsequently shown to be redundant for platelets, and for other blood cell types, in both mice and humans. It is also known under the names adipogenesis inhibitory factor (AGIF) and was developed as a recombinant protein (rhIL-11) as the drug substance oprelvekin.
• Form: Lyophilized powder
• AA Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLR
  RAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IL-11 is > 2 x 10^6 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il11 interleukin 11 [ Mus musculus (house mouse) ]
• Official Symbol: Il11
• Synonyms: IL-11
• Gene ID: 16156
• mRNA Refseq: NM_001290423.2
• Protein Refseq: NP_001277352.1
• UniProt ID: F7A7F2