Active Recombinant Mouse Il11 Protein
Cat.No. : | Il11-085M |
Product Overview : | Purified recombinant protein of Mouse interleukin 11 (Il11) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. |
Bio-activity : | ED50 was determined by the dose-dependent stimulation of the proliferation of murine T11 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg. |
Molecular Mass : | 19.1 kDa |
AA Sequence : | MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il11 interleukin 11 [ Mus musculus (house mouse) ] |
Official Symbol | Il11 |
Synonyms | Il11 interleukin 11; IL-11; interleukin-11 |
Gene ID | 16156 |
mRNA Refseq | NM_008350 |
Protein Refseq | NP_032376 |
UniProt ID | P47873 |
◆ Recombinant Proteins | ||
IL11-151H | Recombinant Human IL11 Protein, His-tagged | +Inquiry |
IL11-2597H | Active Recombinant Human IL11 protein | +Inquiry |
IL11-2016H | Recombinant Human IL11 Protein, Met-tagged | +Inquiry |
IL11-1305C | Recombinant Cynomolgus IL11 protein(Phe22-Leu199) | +Inquiry |
IL11-842H | Recombinant Human IL11 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
0
Inquiry Basket