Active Recombinant Mouse IFN alpha 1a Protein, His-Tagged

Cat.No. : IFN alpha 1a-01M
Product Overview : Recombinant mouse IFN alpha 1a Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interferon alpha-1 or interferon alpha-D, encoded by the human IFNA1gene, is a member of the type I interferon family . It is expressed in peripheral blood leukocytes and lymphoblastoid cells. There are four highly conserved cysteine residues which form two disulfide bonds. One bond is a necessity for biological activity, which plays an critical role in conducting non-specific resistance against a variety of viral infections, and regulation of cell proliferation and modulates immune responses.
Form : Lyophilized powder
AA Sequence : CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQ
LNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 10^7 IU/mg.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFN alpha 1a Products

Required fields are marked with *

My Review for All IFN alpha 1a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon