Active Recombinant Mouse Gdnf Protein
Cat.No. : | Gdnf-066M |
Product Overview : | Purified recombinant protein of Mouse glial cell line derived neurotrophic factor (Gdnf) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Bio-activity : | ED50 was determined by the proliferation of rat C6 cells is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg. |
Molecular Mass : | 15 kDa |
AA Sequence : | MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Gdnf glial cell line derived neurotrophic factor [ Mus musculus (house mouse) ] |
Official Symbol | Gdnf |
Synonyms | Gdnf; glial cell line derived neurotrophic factor; ATF; AI385739; glial cell line-derived neurotrophic factor; astrocyte-derived trophic factor; neurotrophic factor |
Gene ID | 14573 |
mRNA Refseq | NM_010275 |
Protein Refseq | NP_034405 |
UniProt ID | P48540 |
◆ Recombinant Proteins | ||
GDNF-2437H | Recombinant Human GDNF Protein (Ser78-Gly107), N-His and N-SUMO tagged | +Inquiry |
GDNF-6293M | Recombinant Mouse GDNF Protein | +Inquiry |
Gdnf-30M | Recombinant Mouse Gdnf Protein (Ser78-Ile211), C-His tagged, Animal-free, Carrier-free | +Inquiry |
GDNF-7292H | Active Recombinant Human GDNF protein(Arg83-Ile185) | +Inquiry |
Gdnf-595R | Recombinant Rat Gdnf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gdnf Products
Required fields are marked with *
My Review for All Gdnf Products
Required fields are marked with *
0
Inquiry Basket