Active Recombinant Mouse FGF9 Protein

• Cat.No.: FGF9-95M
• Product Overview: Recombinant Mouse FGF9 Protein without tag was expressed in E. coli.

Specification

• Description: Fibroblast growth factor 9 (FGF-9) is a mitogen and survival factor for nerve and mesenchymal cells. FGF-9 functions as an autocrine and paracrine factor to support the growth and survival of motor neurons and prostate tissue. FGF-9 expression in the gonad is also necessary for sex determination.
• Source: E. coli
• Species: Mouse
• Bio-activity: NR6R 3T3 proliferation, ED50≤10 ng/mL
• Molecular Mass: Monomer, 23.4 kDa (207 aa)
• AA Sequence: MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Fgf9 fibroblast growth factor 9 [ Mus musculus (house mouse) ]
• Official Symbol: FGF9
• Synonyms: FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks
• Gene ID: 14180
• mRNA Refseq: NM_013518
• Protein Refseq: NP_038546
• UniProt ID: P54130