Active Recombinant Mouse Fgf18 Protein (172 aa)

• Cat.No.: Fgf18-417F
• Product Overview: Recombinant mouse Fibroblast Growth Factor 18 (rmFGF-18) produced in E. coli is a single non-glycosylated polypeptide chain containing of 172 amino acids. A fully biologically active molecule, rmFGF-18 has a molecular mass of 20.1 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Description: Fibroblast Growth Factor 18 (FGF-18) is a pleiotropic cytokine belonging to the heparin-binding FGF family, which has 23 different members. Structurally, FGF-18 is closely related to FGF-8 and FGF-17. Like other FGFs, FGF-18 can bind to different FGF receptors in vivo. FGF-18 is expressed in various tissues and has multiple functions: during long bone growth, FGF-18 is expressed in perichondrium and developing joints, and regulates bone formation by inhibiting chondrocyte proliferation and differentiation; FGF-18 knock-out mice survive embryonic development, but exhibit skeletal abnormalities and die in the early neonatal period. FGF-18 also induces ectopic cartilage formation in the lung, and alters the morphology of the pulmonary mesenchyma.
• Source: E. coli
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^3 units/mg.
• Molecular Mass: 20.1 kDa, observed by non-reducing SDS-PAGE.
• Protein length: 172
• AA Sequence: EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouse Fibroblast Growth Factor 18 (rmFGF-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-18 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Fgf18 fibroblast growth factor 18 [ Mus musculus ]
• Official Symbol: Fgf18
• Synonyms: FGF18; fibroblast growth factor 18; zFGF5; FGF-18; D130055P09Rik
• Gene ID: 14172
• mRNA Refseq: NM_008005
• Protein Refseq: NP_032031
• UniProt ID: O89101