Active Recombinant Mouse Fgf18 Protein (172 aa)

Cat.No. : Fgf18-417F
Product Overview : Recombinant mouse Fibroblast Growth Factor 18 (rmFGF-18) produced in E. coli is a single non-glycosylated polypeptide chain containing of 172 amino acids. A fully biologically active molecule, rmFGF-18 has a molecular mass of 20.1 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 172
Description : Fibroblast Growth Factor 18 (FGF-18) is a pleiotropic cytokine belonging to the heparin-binding FGF family, which has 23 different members. Structurally, FGF-18 is closely related to FGF-8 and FGF-17. Like other FGFs, FGF-18 can bind to different FGF receptors in vivo. FGF-18 is expressed in various tissues and has multiple functions: during long bone growth, FGF-18 is expressed in perichondrium and developing joints, and regulates bone formation by inhibiting chondrocyte proliferation and differentiation; FGF-18 knock-out mice survive embryonic development, but exhibit skeletal abnormalities and die in the early neonatal period. FGF-18 also induces ectopic cartilage formation in the lung, and alters the morphology of the pulmonary mesenchyma.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^3 units/mg.
Molecular Mass : 20.1 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant mouse Fibroblast Growth Factor 18 (rmFGF-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-18 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Fgf18 fibroblast growth factor 18 [ Mus musculus ]
Official Symbol Fgf18
Synonyms FGF18; fibroblast growth factor 18; zFGF5; FGF-18; D130055P09Rik;
Gene ID 14172
mRNA Refseq NM_008005
Protein Refseq NP_032031
UniProt ID O89101

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Fgf18 Products

Required fields are marked with *

My Review for All Fgf18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon