Active Recombinant Mouse Fgf1 Protein

• Cat.No.: Fgf1-057M
• Product Overview: Purified recombinant protein of Mouse fibroblast growth factor 1 (Fgf1) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Broad expression in lung adult (RPKM 20.2), heart adult (RPKM 15.2) and 16 other tissues.
• Bio-activity: Assay #1: ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of heparin is less than or equal to 0.5 ng/ml corresponding to a specific activity of > 2 x 10^6 units/mg. Assay #2: ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is less than or equal to 0.2 ng/ml in the presence of 10 ug/mL heparin, corresponding to a specific activity of > 5 x 10^6 units/mg.
• Molecular Mass: 15.9 kDa
• AA Sequence: MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf1
• Synonyms: Fgf1; fibroblast growth factor 1; Fam; Fgfa; Dffrx; Fgf-1; fibroblast growth factor 1; HBGF-1; aFGF; acidic fibroblast growth factor; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1
• Gene ID: 14164
• mRNA Refseq: NM_010197
• Protein Refseq: NP_034327
• UniProt ID: P61148