Active Recombinant Mouse FGF-8c Protein (247 aa)

• Cat.No.: FGF-8c-409F
• Product Overview: Recombinant mouse Fibroblast Growth Factor 8c (rmFGF-8c) produced in E. coli is a single non-glycosylated polypeptide chain containing 247 amino acids. A fully biologically active molecule, rmFGF-8c has a molecular mass of 28.2 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• ProteinLength: 247
• Description: Fibroblast Growth Factor 8c (FGF-8c) is a cytokine belonging to the heparin-binding FGF family, which has at least 23 members. In different species, e.g. human and mouse, FGF-8 has 8 different isoforms, from FGF-8a to FGF-8h. Different FGF-8 isoforms have different affinities to the receptors, thus conduct different signaling cascade pathways. FGF-8 has very widespread expression pattern during embryonic development, and is an organizer and inducer for gastrulation, somitogenesis, morphogenesis, and limb induction. However, FGF-8 is also a potential oncogene: in normal adult cells, FGF-8 has very low expression; on the other hand, FGF-8 is highly expressed in cancer cells of breast, prostate, and ovarian tumors. FGF-8 promotes tumor angiogenesis by increasing neovascularization, and induces osteoblastic differentiation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 150 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 6.7 × 10^3 units/mg.
• Molecular Mass: 28.2 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouse Fibroblast Growth Factor 8c (rmFGF-8c) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-8c should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Official Symbol: FGF-8c
• Synonyms: Fibroblast Growth Factor 8c; FGF-8c