Active Recombinant Mouse Egf Protein (54 aa)

Cat.No. : Egf-427E
Product Overview : Recombinant mouse Epidermal Growth Factor (rmEGF) produced in E. coli is a single non-glycosylated polypeptide chain containing 54 amino acids. A fully biologically active molecule, rmEGF is obtained by proprietary chromatographic techniques with a molecular mass of 6.2kDa analyzed by reducing SDS-PAGE.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 54
Description : Epidermal Growth Factor (EGF) was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth inhibition, and stunting of growth when injected into newborn mice. EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-alpha and VGF (vaccinia virus growth factor).
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.1 ng/mL, measured by a cell proliferation assay using BALB/c 3T3 cells, corresponding to a specific activity of > 1.0 × 10^7units/mg.
Molecular Mass : 6.2 kDa, observed by reducing SDS-PAGE.
AA Sequence : MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analysis.
Storage : Lyophilized recombinant mouse Epidermal Growth Factor (rmEGF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmEGF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Egf epidermal growth factor [ Mus musculus ]
Official Symbol Egf
Synonyms EGF; epidermal growth factor; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF); AI790464;
Gene ID 13645
mRNA Refseq NM_010113
Protein Refseq NP_034243
UniProt ID P01132

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Egf Products

Required fields are marked with *

My Review for All Egf Products

Required fields are marked with *

0
cart-icon
0
compare icon