Active Recombinant Mouse Ctf1 Protein

• Cat.No.: Ctf1-049M
• Product Overview: Purified recombinant protein of Mouse cardiotrophin 1 (Ctf1) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
• Bio-activity: The ED50 as determined by the dose-dependent proliferation of TF-1 cells was < 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
• Molecular Mass: 21.3 kDa
• AA Sequence: SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ctf1 cardiotrophin 1 [ Mus musculus (house mouse) ]
• Official Symbol: Ctf1
• Synonyms: Ctf1; cardiotrophin 1; CT-1; cardiotrophin-1
• Gene ID: 13019
• mRNA Refseq: NM_007795
• Protein Refseq: NP_031821
• UniProt ID: Q60753