Active Recombinant Mouse Csf2 Protein (125 aa)

• Cat.No.: Csf2-391C
• Product Overview: Recombinant Mouse GM-CSF produced in E. coli is a single non-glycosylated polypeptide chain containing 125 amino acids. A fully biologically active molecule, rmGM-CSF has a molecular mass of 14.3 kD analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 125
• Description: Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine and other immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor that activates effector functions of granulocytes, monocytes/macrophages and eosinophils.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 pg/mL, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 8 units/mg.
• Molecular Mass: 14.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE&HPLC.
• Storage: Lyophilized recombinant Mouse GM-CSF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse GM-CSF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus ]
• Official Symbol: Csf2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; put. GM-CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; Csfgm; GMCSF; Gm-CSf; MGI-IGM; MGC151255; MGC151257
• Gene ID: 12981
• mRNA Refseq: NM_009969
• Protein Refseq: NP_034099
• UniProt ID: P01587