Active Recombinant Mouse Csf2 Protein (124 aa)

• Cat.No.: Csf2-033C
• Product Overview: Recombinant Mouse Csf2 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 124
• Description: GM-CSF was initially characterized as a factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is also a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. GM-CSF is produced by a number of different cell types (including T cells, B cells, macrophages, mast cells, endothelial cells, fibroblasts, and adipocytes) in response to cytokine or inflammatory stimuli. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effector functions of granulocytes, monocytes/macrophages, and eosinophils (1, 2). GM-CSF promotes a Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity (3 - 5). It shows clinical effectiveness in ameliorating chemotherapy-induced neutropenia, and GM-CSF transfected tumor cells are utilized as cancer vaccines (6, 7). The 22 kDa glycosylated GM-CSF, similar to IL-3 and IL-5, is a cytokine with a core of four bundled α-helices (8 - 10). Mature mouse GM-CSF shares 49% - 54% amino acid sequence identity with canine, feline, human, and porcine GM-CSF and 69% with rat GM-CSF. GM-CSF exerts its biological effects through a heterodimeric receptor complex composed of GM-CSF Rα/CD116 and the signal transducing common β chain (CD131) which is also a component of the high-affinity receptors for IL-3 and IL-5 (11, 12). In addition, GM-CSF binds a naturally occurring soluble form of GM-CSF Rα (13). The activity of GM-CSF is species specific between human and mouse. Mouse GM-CSF is only weakly active on rat cells, although rat GM-CSF is fully active on mouse cells (14, 15).
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is ≤ 0.2 ng/mL, corresponding to a specific activity of ≥ 5 × 10^6 units/mg.
• Molecular Mass: Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 124 amino acids residues.
• AA Sequence: MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Endotoxin: Less than 1 EU/mg of rmGM-CSF as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus ]
• Official Symbol: Csf2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; put. GM-CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; Csfgm; GMCSF; Gm-CSf; MGI-IGM; MGC151255; MGC151257
• Gene ID: 12981
• mRNA Refseq: NM_009969
• Protein Refseq: NP_034099
• UniProt ID: P01587