Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
197 |
Description : |
Ciliary Neurotrophic Factor (CNTF) is a polypeptide hormone which acts within the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. CNTF is a potent survival factor for neurons and oligodendrocytes and may play a role in reducing tissue damage during increased inflammation. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, however this phenotype is not causally related to neurologic disease. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 30 ng/mL, measured by its ability to induce alkaline phosphatase production byTF-1 Cells. |
Molecular Mass : |
22.6 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant Mouse CNTF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse CNTF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |