Active Recombinant Mouse Cd200 Protein, His-tagged
| Cat.No. : | Cd200-027M |
| Product Overview : | Recombinant mouse CD200, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. |
| Source : | Insect cells |
| Species : | Mouse |
| Tag : | His |
| Form : | Liquid |
| Bio-activity : | Measured by its binding ability in a functional ELISA with Mouse CD200 R1. |
| Molecular Mass : | 23.5 kDa |
| AA Sequence : | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -106 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | Cd200 CD200 antigen [ Mus musculus (house mouse) ] |
| Official Symbol | Cd200 |
| Synonyms | Cd200; CD200 antigen; OX; Mox; OX2; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; antigen identified by monoclonal antibody MRC OX-2 |
| Gene ID | 17470 |
| mRNA Refseq | NM_010818 |
| Protein Refseq | NP_034948 |
| UniProt ID | O54901 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *
0
Inquiry Basket
