Active Recombinant Mouse CCL4 Protein

• Cat.No.: Ccl4-26M
• Product Overview: Recombinant Mouse CCL4 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Macrophage inflammatory protein-1 beta (MIP-1 β), also known as CCL4, is produced by macrophages and functions as a mitogen-inducible cytokine. MIP-1 β signals through the chemokine receptor CCR5 to chemoattract immune cells. MIP-1 β induces inflammatory responses, including neutrophil superoxide production. The MIP-1 β and MIP-1 α heterodimer exhibits antiviral activity against the human immunodeficiency virus 1 (HIV-1).
• Bio-activity: THP-1 chemotaxis, ≤100 ng/mL
• Molecular Mass: Monomer, 7.8 kDa (69 aa)
• AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ccl4 chemokine (C-C motif) ligand 4 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl4
• Synonyms: CCL4; chemokine (C-C motif) ligand 4; C-C motif chemokine 4; ACT2; SIS-gamma; MIP-1 beta; MIP-1-beta; immune activation protein 2; small inducible cytokine A4; small-inducible cytokine A4; macrophage inflammatory protein 1-beta; Act-2; Mip1b; Scya4; MIP-1B; AT744.1
• Gene ID: 20303
• mRNA Refseq: NM_013652
• Protein Refseq: NP_038680
• UniProt ID: Q5QNV9