Active Recombinant Mouse Ccl4 Protein
Cat.No. : | Ccl4-2038M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 4 (Ccl4) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Monokine with inflammatory and chemokinetic properties. |
Bio-activity : | Determined by its ability to chemoattract human monocytes using a concentration range of 20.0-100.0 ng/mL. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Ccl4 chemokine (C-C motif) ligand 4 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl4 |
Synonyms | Ccl4; chemokine (C-C motif) ligand 4; Mip; Scy; Act-; MIP-; Act-2; Mip1b; Scya4; AT744.; MIP-1B; AT744.1; C-C motif chemokine 4; ACT2; MIP-1-beta; SIS-gamma; immune activation protein 2; macrophage inflammatory protein 1-beta; small-inducible cytokine A4 |
Gene ID | 20303 |
mRNA Refseq | NM_013652 |
Protein Refseq | NP_038680 |
UniProt ID | P14097 |
◆ Recombinant Proteins | ||
CCL4-631C | Active Recombinant Canine CCL4 | +Inquiry |
CCL4-75M | Recombinant Mouse CCL4 | +Inquiry |
CCL4-2235C | Recombinant Chicken CCL4 | +Inquiry |
CCL4-119H | Active Recombinant Human Chemokine (C-C Motif) Ligand 4, MIgG2a Fc-tagged | +Inquiry |
CCL4-71H | Recombinant Human CCL4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl4 Products
Required fields are marked with *
My Review for All Ccl4 Products
Required fields are marked with *
0
Inquiry Basket