Active Recombinant Mouse Ccl4 Protein

• Cat.No.: Ccl4-2038M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 4 (Ccl4) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Monokine with inflammatory and chemokinetic properties.
• Bio-activity: Determined by its ability to chemoattract human monocytes using a concentration range of 20.0-100.0 ng/mL.
• Molecular Mass: 7.8 kDa
• AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Ccl4 chemokine (C-C motif) ligand 4 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl4
• Synonyms: Ccl4; chemokine (C-C motif) ligand 4; Mip; Scy; Act-; MIP-; Act-2; Mip1b; Scya4; AT744.; MIP-1B; AT744.1; C-C motif chemokine 4; ACT2; MIP-1-beta; SIS-gamma; immune activation protein 2; macrophage inflammatory protein 1-beta; small-inducible cytokine A4
• Gene ID: 20303
• mRNA Refseq: NM_013652
• Protein Refseq: NP_038680
• UniProt ID: P14097