Active Recombinant Mouse Ccl3 Protein (69 aa)

Cat.No. : Ccl3-171C
Product Overview : Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1α) produced in HEK 293 cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1αhas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 69
Description : MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1αchemoattracts macrophages in order to accelerate the tissue repair process.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of mouse MIP-1α/CCL3 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells) is less than 100 ng/mL.
Molecular Mass : 7.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Mouse MIP-1α/CCL3 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution Mouse MIP-1α/CCL3 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus ]
Official Symbol Ccl3
Synonyms CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; TY-5; L2G25B; MIP1 (a); SIS-alpha; MIP-1 alpha; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; heparin-binding chemotaxis protein; macrophage inflammatory protein-1alpha; macrophage inflammatory protein 1-alpha; Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha;
Gene ID 20302
mRNA Refseq NM_011337
Protein Refseq NP_035467
UniProt ID P10855

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl3 Products

Required fields are marked with *

My Review for All Ccl3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon