Active Recombinant Mouse Ccl3 Protein (69 aa)
Cat.No. : | Ccl3-171C |
Product Overview : | Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1α) produced in HEK 293 cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1αhas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 69 |
Description : | MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1αchemoattracts macrophages in order to accelerate the tissue repair process. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of mouse MIP-1α/CCL3 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells) is less than 100 ng/mL. |
Molecular Mass : | 7.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Mouse MIP-1α/CCL3 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution Mouse MIP-1α/CCL3 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus ] |
Official Symbol | Ccl3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; TY-5; L2G25B; MIP1 (a); SIS-alpha; MIP-1 alpha; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; heparin-binding chemotaxis protein; macrophage inflammatory protein-1alpha; macrophage inflammatory protein 1-alpha; Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha; |
Gene ID | 20302 |
mRNA Refseq | NM_011337 |
Protein Refseq | NP_035467 |
UniProt ID | P10855 |
◆ Recombinant Proteins | ||
CCL3-021H | Recombinant Human CCL3 Protein, Biotinylated | +Inquiry |
CCL3-1396M | Recombinant Mouse CCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL3-705H | Recombinant Human CCL3 protein, His & GST-tagged | +Inquiry |
CCL3-5633H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
Ccl3-56R | Recombinant Rat Ccl3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl3 Products
Required fields are marked with *
My Review for All Ccl3 Products
Required fields are marked with *
0
Inquiry Basket