Active Recombinant Mouse Ccl28 Protein

• Cat.No.: Ccl28-152M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 28 (Ccl28) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Chemotactic for resting CD4, CD8 T-cells and eosinophils. Binds to CCR10 and induces calcium mobilization in a dose-dependent manner.
• Bio-activity: Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/ml.
• Molecular Mass: 12.6 kDa
• AA Sequence: SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl28 chemokine (C-C motif) ligand 28 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl28
• Synonyms: Ccl28; chemokine (C-C motif) ligand 28; MEC; CCK1; Scya28; C-C motif chemokine 28; small-inducible cytokine A28
• Gene ID: 56838
• mRNA Refseq: NM_020279
• Protein Refseq: NP_064675
• UniProt ID: Q9JIL2