Active Recombinant Mouse Ccl24 Protein (93 aa)

Cat.No. : Ccl24-046C
Product Overview : Recombinant Mouse Ccl24 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 93
Description : Eotaxin, also named MPIF-2 and Ckβ6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. Mouse Eotaxin-2 cDNA encodes a 119 amino acid (aa) residue precursor protein that shares approximately 58% aa sequence identity with human Eotaxin-2. Functionally, Eotaxin-2 is most closely related to Eotaxin/CCL11 and Eotaxin-3/CCL26.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract murine lymphocytes using a concentration range of 10.0 -100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg.
Molecular Mass : 10.3 kDa, a single, non-glycosylated polypeptide chain containing 93 amino acids.
AA Sequence : VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Endotoxin : Less than 1 EU/μg of rMuEotaxin-2/CCL24 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl24 chemokine (C-C motif) ligand 24 [ Mus musculus ]
Official Symbol Ccl24
Synonyms CCL24; chemokine (C-C motif) ligand 24; C-C motif chemokine 24; eotaxin-2; CC chemokine CCL24; small inducible cytokine A24; small-inducible cytokine A24; eosinophil chemotactic protein 2; CKb-6; MPIF-2; Scya24;
Gene ID 56221
mRNA Refseq NM_019577
Protein Refseq NP_062523
UniProt ID Q9JKC0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl24 Products

Required fields are marked with *

My Review for All Ccl24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon