Active Recombinant Mouse Ccl22 Protein (68 aa)

• Cat.No.: Ccl22-042C
• Product Overview: Recombinant Mouse Ccl22 Protein without tag was expressed in E. coli.

Specification

• Product Overview: Recombinant Mouse Ccl22 Protein without tag was expressed in E. coli.
• Description: MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells and exerts HIV suppressive activity.
• Source: E. coli
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human activated lymphocytes using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^4 IU/mg.
• Molecular Mass: 7.8 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids.
• Protein length: 68
• AA Sequence: GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
• Endotoxin: Less than 1 EU/μg of rMuMDC/CCL22 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl22 chemokine (C-C motif) ligand 22 [ Mus musculus ]
• Official Symbol: Ccl22
• Synonyms: CCL22; chemokine (C-C motif) ligand 22; C-C motif chemokine 22; CC chemokine ABCD-1; small-inducible cytokine A22; activated B and dendritic cell-derived; small inducible cytokine subfamily A22; dendritic cell and B cell derived chemokine; small inducible cytokine subfamily A, member 22; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); MDC; DCBCK; ABCD-1; Scya22
• Gene ID: 20299
• mRNA Refseq: NM_009137
• Protein Refseq: NP_033163
• UniProt ID: O88430