Active Recombinant Mouse Ccl21a Protein (110 aa)

• Cat.No.: Ccl21a-045C
• Product Overview: Recombinant Mouse Ccl21a Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 110
• Description: Exodus-2/CCL21 is a novel CC chemokine discovered independently by three groups from the EST database, and shows 21-33% identity to other CC chemokines. Exodus-2 contains the four conserved cysteines characteristic of β chemokines plus two additional cysteines in its unusually long carboxylterminal domain. It is expressed in lymph nodes of certain endothelial cells, and in the spleen and appendix. Exodus-2 chemoattracts T and B lymphocytes and inhibits hematopoiesis.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract total murine T cell population using a concentration range of 10.0 -100.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^4 IU/mg.
• Molecular Mass: 12.0 kDa, a single, non-glycosylated polypeptide chain containing 110 amino acids.
• AA Sequence: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
• Endotoxin: Less than 1 EU/μg of rMuExodus-2/CCL21 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl21a chemokine (C-C motif) ligand 21A (serine) [ Mus musculus (house mouse) ]
• Official Symbol: Ccl21a
• Synonyms: Ccl21a; chemokine (C-C motif) ligand 21A (serine); ALP; SLC; plt; CKb9; Tca4; 6Ckine; Gm1987; Scya21; 6CKBAC2; SCYA21a; Scya21b; C-C motif chemokine 21a; CC chemokine 6Ckine-ser; CCL21-Ser; beta-chemokine exodus-2; exodus-2; small inducible cytokine A21a; thymus-derived chemotactic agent 4
• Gene ID: 18829
• mRNA Refseq: NM_011124
• Protein Refseq: NP_035254
• UniProt ID: P84444