Active Recombinant Mouse CCL2 Protein

• Cat.No.: CCL2-15M
• Product Overview: Recombinant Mouse CCL2 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is produced by injured or infected tissues. MCP-1 signals through the CCR2 and CCR4 G protein-coupled receptors to recruit memory T cells, monocytes, and dendritic cells to sites of inflammation.
• Bio-activity: THP-1 chemotaxis, ≤100 ng/mL
• Molecular Mass: Monomer, 13.8 kDa (125 aa)
• AA Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ]
• Official Symbol: CCL2
• Synonyms: CCL2; chemokine (C-C motif) ligand 2; C-C motif chemokine 2; small inducible cytokine A2; small-inducible cytokine A2; monocyte chemotactic protein 1; monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; platelet-derived growth factor-inducible protein JE; JE; HC11; MCAF; MCP1; MCP-1; Scya2; Sigje; SMC-CF; AI323594
• Gene ID: 20296
• mRNA Refseq: NM_011333
• Protein Refseq: NP_035463
• UniProt ID: P10148