Active Recombinant Mouse Ccl11 Protein (74 aa)

Cat.No. : Ccl11-035C
Product Overview : Recombinant Mouse Ccl11 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 74
Description : Eotaxin also called CCL11 is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN-gamma stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and along Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung, and in allergic reactions.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured by its ability to chemoattract mouse CCR3 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 1-5 ng/mL.
Molecular Mass : Approximately 8.3 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
AA Sequence : HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Endotoxin : Less than 1 EU/μg of rMuEotaxin/CCL11 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl11 chemokine (C-C motif) ligand 11 [ Mus musculus ]
Official Symbol Ccl11
Synonyms CCL11; chemokine (C-C motif) ligand 11; eotaxin; C-C motif chemokine 11; small inducible cytokine A11; small-inducible cytokine A11; eosinophil chemotactic protein; small chemokine (C-C motif) ligand 11; Scya11;
Gene ID 20292
mRNA Refseq NM_011330
Protein Refseq NP_035460
UniProt ID P48298

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl11 Products

Required fields are marked with *

My Review for All Ccl11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon