Active Recombinant Mouse Ccl11 Protein (74 aa)

• Cat.No.: Ccl11-035C
• Product Overview: Recombinant Mouse Ccl11 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• ProteinLength: 74
• Description: Eotaxin also called CCL11 is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN-gamma stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and along Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung, and in allergic reactions.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Measured by its ability to chemoattract mouse CCR3 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 1-5 ng/mL.
• Molecular Mass: Approximately 8.3 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
• Endotoxin: Less than 1 EU/μg of rMuEotaxin/CCL11 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl11 chemokine (C-C motif) ligand 11 [ Mus musculus ]
• Official Symbol: Ccl11
• Synonyms: CCL11; chemokine (C-C motif) ligand 11; eotaxin; C-C motif chemokine 11; small inducible cytokine A11; small-inducible cytokine A11; eosinophil chemotactic protein; small chemokine (C-C motif) ligand 11; Scya11
• Gene ID: 20292
• mRNA Refseq: NM_011330
• Protein Refseq: NP_035460
• UniProt ID: P48298