Active Recombinant Mouse Ccl11 Protein

Cat.No. : Ccl11-128M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 11 (Ccl11) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils.
Bio-activity : Murine Eotaxin was found to induce chemotaxis of purified eosinophils at concentrations ranging between 100-1000 ng/ml.
Molecular Mass : 8.4 kDa
AA Sequence : HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Ccl11 chemokine (C-C motif) ligand 11 [ Mus musculus (house mouse) ]
Official Symbol Ccl11
Synonyms Ccl11; chemokine (C-C motif) ligand 11; Scya11; eotaxin; eotaxin; C-C motif chemokine 11; eosinophil chemotactic protein; small chemokine (C-C motif) ligand 11; small-inducible cytokine A11
Gene ID 20292
mRNA Refseq NM_011330
Protein Refseq NP_035460
UniProt ID P48298

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl11 Products

Required fields are marked with *

My Review for All Ccl11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon