Active Recombinant Mouse Btc Protein

• Cat.No.: Btc-193B
• Product Overview: Recombinant Mouse Btc Protein without tag was expressed in HEK 293.

Specification

• Species: Mouse
• Source: HEK293
• Description: Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.08 ng/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 19-24 kDa, observed by reducing SDS-PAGE.
• AA Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Btc betacellulin, epidermal growth factor family member [ Mus musculus ]
• Official Symbol: Btc
• Synonyms: BTC; betacellulin, epidermal growth factor family member; betacellulin; probetacellulin; Bcn
• Gene ID: 12223
• mRNA Refseq: NM_007568
• Protein Refseq: NP_031594
• UniProt ID: Q05928