Active Recombinant Mouse beta-NGF Protein

• Cat.No.: NGF-214M
• Product Overview: Recombinant Mouse beta-NGF Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Nerve growth factor beta (β-NGF) is a neurotrophic factor that is important for the development and maintenance of sensory and sympathetic neurons. β-NGF signals through the low affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase A (TrkA) to activate PI3K, Ras, and PLC signaling pathways. β-NGF is also involved in the growth, differentiation, and survival of B lymphocytes. Human, mouse, and rat β-NGF proteins are cross-reactive.
• Bio-activity: TF-1 cell proliferation, ≤5 ng/mL
• Molecular Mass: Noncovalent homodimer, 13.6 kDa/27.2 kDa (121/242 amino acids)
• AA Sequence: MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ngf nerve growth factor [ Mus musculus (house mouse) ]
• Official Symbol: NGF
• Synonyms: NGF; nerve growth factor; beta-nerve growth factor; beta-NGF; nerve growth factor, beta; Ngfb
• Gene ID: 18049
• mRNA Refseq: NM_001112698
• Protein Refseq: NP_001106168
• UniProt ID: P01139