Active Recombinant Mouse 4632428N05Rik, Fc-tagged

• Cat.No.: C10orf54-26M
• Product Overview: Recombinant Mouse 4632428N05Rik(Phe33 - Ala191), exists as a dimer under non-reducing condition, fused to Fc fusion from human IgG1 at C-terminus, was expressed in Human cells.

Specification

• Description: B7-H5 (B7 homolog 5), also known as platelet receptor Gi24, C10orf54, Dies1, VISTA, PD-1H and SISP1, is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Unlike other B7 family members that usually contain one Ig V-like and one Ig C-like domain in the extracellular region, mature B7-H5 has only one Ig V- like domain. B7-H5 is expressed in bone, on embryonic stem cells (ESCs), and on tumor cell surfaces. On ESCs, it interacts with BMP-4 and potentiates BMP signaling and the transition from an undifferentiated to a differentiated state. On tumor cells, B7-H5 both promotes MT1-MMP expression and activity and serves as a substrate for MT1-MMP. This increases the potential for cell motility. B7-H5 can be shed by MT1­MMP, generating a soluble 30 kDa extracellular fragment and a 25-30 kDa membrane-bound fragment. B7-H5 is expressed on the surface of naïve CD4+ T cells and regulatory T cells. Its expression is up­regulated in vivo on activated monocytes and dendritic cells. It is reported that B7-H5 inhibits CD4+ and CD8+ T cell proliferation, and their production of IL­2 and IFN­γ. Its expression on tumor cells attenuates the anti­tumor immune response and enables more rapid tumor progression. In contrast, it has also been reported that B7-H5 limits disease progression in the autoimmune disease model EAE.
• Source: Human cells
• Species: Mouse
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
• Bio-activity: Inhibits anti­CD3e antibody induced IL­2 secretion and T cell proliferation.
• Molecular Mass: Calculated molecular mass 43.3 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
• AA Sequence: FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAA NTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVY PSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
• Purity: >95% judged by SDS-PAGE under reducing condition
• Stability: It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
• Warning: FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
• Protein length: 33-191 a.a.

Gene Information

• Gene Name: 4632428N05Rik RIKEN cDNA 4632428N05 gene [ Mus musculus ]
• Official Symbol: 4632428N05Rik
• Synonyms: Dies1; PD-1H; VISTA; platelet receptor Gi24; differentiation of ESCs 1
• Gene ID: 74048
• mRNA Refseq: NM_001159572
• Protein Refseq: NP_001153044
• UniProt ID: Q9D659
• Chromosome Location: 10; 10 B4
• Function: protein binding