Active Recombinant Human VEGF165

Cat.No. : VEGFA-156H
Product Overview : Recombinant Human vascular endothelial growth factor A was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Vascular endothelial growth factor (VEGF) is a member of the cysteine-knot growth factor superfamily. Five VEGF splice variants exist including VEGF-121, VEGF-145, VEGF-165, VEGF-189; and VEGF-206. VEGF-165 is the most abundant and active isoform. VEGF-165 functions as a growth factor in angiogenesis, vasculogenesis and endothelial cell growth. VEGF-165 acts as a specific mitogen and survival factor for vascular endothelial cells, inducing microvascular permeability, cell migration and regulates the differentiation and survival of hematopoietic progenitor cells to affect hematopoiesis, immune function and tumour progression. VEGF-165 also plays roles in neurogenesis and blood brain barrier function.
Theoretical Sequence : APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMR CGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRA RQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR.
Molecular Mass : VEGF-165 migrates as a band between 15 and 25 kDa in SDS-PAGE. This compares with the predicted molecular mass of 19.2kDa.
PI : Unmodified human VEGF-165 has a predicted pI of 7.6.
Purity : >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C.
Activity : The ED50of VEGF-165 is typically 0.2 - 2.0 ng/ml as measured in a cell proliferation assay using human umbilical vein endothelial (HUVEC) cells.
Gene Name VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Synonyms vascular endothelial growth factor A; VPF; VEGF; MVCD1; VEGF-A; MGC70609; VEGFA; vascular permeability factor; vascular endothelial growth factor isoform VEGF165; Vascular permeability factor
Gene ID 7422
mRNA Refseq NM_001025366
Protein Refseq NP_001020537
MIM 192240
UniProt ID P15692
Chromosome Location 6p12
Pathway Bladder cancer; Cytokine-cytokine receptor interaction; Focal adhesion; Pancreatic cancer; Pathways in cancer; Renal cell carcinoma; VEGF signaling pathway; mTOR signaling pathway; Hemostasis; Signaling by VEGF
Function cell surface binding; cytokine activity; extracellular matrix binding; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein homodimerization activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon