Active Recombinant Human TNFSF14 protein, hFc-Myc-tagged

• Cat.No.: TNFSF14-4603H
• Product Overview: Recombinant Human TNFSF14 protein(O43557)(74-240aa), fused to N-terminal hFc tag and Myc tag, was expressed in Mammalian cell.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Fc&Myc
• Protein Length: 74-240aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.
• Molecular Mass: 46.7 kDa
• AA Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 88% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TNFSF14 tumor necrosis factor (ligand) superfamily, member 14 [ Homo sapiens ]
• Official Symbol: TNFSF14
• Synonyms: TNFSF14; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; CD258; HVEM L; LIGHT; LTg; delta transmembrane LIGHT; herpesvirus entry mediator A; herpesvirus entry mediator ligand; herpesvirus entry mediator-ligand; herpes virus entry mediator ligand; ligand for herpesvirus entry mediator; tumor necrosis factor receptor-like 2; tumor necrosis factor superfamily member LIGHT; TR2; HVEML
• Gene ID: 8740
• mRNA Refseq: NM_003807
• Protein Refseq: NP_003798
• MIM: 604520
• UniProt ID: O43557