Active Recombinant Human TNFSF11 protein, His tagged

• Cat.No.: TNFSF11-019H
• Product Overview: Recombinant human TNFSF11 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.

Specification

• Description: This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 140-317 aa
• Form: Liquid
• Bio-activity: Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 range ≤ 25 ng/mL.
• Molecular Mass: 22.3 kDa
• AA Sequence: < MGSSHHHHHHSSGLVPRGSHM> IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
• Endotoxin: < 1 EU/μg of protein determined by LAL method
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
• References: 1. Lam J., et al. (2001) J. Clin. Invest. 108:971-979 Ito S., et al. (2002) J. Biol. Chem. 277:6631-6636

Gene Information

• Gene Name: TNFSF11 tumor necrosis factor (ligand) superfamily, member 11 [ Homo sapiens (human) ]
• Official Symbol: TNFSF11
• Synonyms: TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; CD254; ODF; OPGL; RANKL; TRANCE; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; sOdf; OPTB2; hRANKL2
• Gene ID: 8600
• mRNA Refseq: NM_003701
• Protein Refseq: NP_003692
• MIM: 602642
• UniProt ID: O14788