Active Recombinant Human TNFSF11 protein, His tagged

Cat.No. : TNFSF11-019H
Product Overview : Recombinant human TNFSF11 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 140-317 aa
Description : This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
Tag : N-His
Form : Liquid
Bio-activity : Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 range ≤ 25 ng/mL.
Molecular Mass : 22.3 kDa
AA Sequence : < MGSSHHHHHHSSGLVPRGSHM> IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Endotoxin : < 1 EU/μg of protein determined by LAL method
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
References : 1. Lam J., et al. (2001) J. Clin. Invest. 108:971-979 Ito S., et al. (2002) J. Biol. Chem. 277:6631-6636
Gene Name TNFSF11 tumor necrosis factor (ligand) superfamily, member 11 [ Homo sapiens (human) ]
Official Symbol TNFSF11
Synonyms TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; CD254; ODF; OPGL; RANKL; TRANCE; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; sOdf; OPTB2; hRANKL2
Gene ID 8600
mRNA Refseq NM_003701
Protein Refseq NP_003692
MIM 602642
UniProt ID O14788

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFSF11 Products

Required fields are marked with *

My Review for All TNFSF11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon