Active Recombinant Human TNFRSF1B Protein

• Cat.No.: TNFRSF1B-01H
• Product Overview: Recombinant human TNFRSF1B protein without tag was expressed in E. coli. The TNFR2 is purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 24-206 a.a.
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 as determined by its ability to inhibit the TNF-a mediated cytotoxicity in the L-929 cells is less than 0.2 μg/mL, corresponding to a specific activity of > 5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-a.
• Molecular Mass: 20 kDa
• AA Sequence: MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT.
• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Stability: Lyophilized TNFR2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution TNFR2 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  Please prevent freeze-thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized TNFR2 in sterile 18M-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.
• Shipping: Shipped at Room temp.

Gene Information

• Gene Name: TNFRSF1B TNF receptor superfamily member 1B [ Homo sapiens (human) ]
• Official Symbol: TNFRSF1B TNF receptor superfamily member 1B [ Homo sapiens (human) ]
• Synonyms: TNFRSF1B; TNF receptor superfamily member 1B; p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II; tumor necrosis factor receptor superfamily member 1B; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; tumor necrosis factor beta receptor; tumor necrosis factor binding protein 2; tumor necrosis factor receptor 2; tumor necrosis factor receptor type II
• Gene ID: 7133
• mRNA Refseq: NM_001066
• Protein Refseq: NP_001057
• MIM: 191191
• UniProt ID: P20333