Active Recombinant Human TNFRSF1A Protein
Cat.No. : | TNFRSF1A-252H |
Product Overview : | Recombinant Human TNFRSF1A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Tumor necrosis factor receptor type 1 (TNFR1) is expressed in most tissues and is activated by soluble and membrane-bound tumor necrosis factor alpha (TNFa). TNFR1 activates NF-κB and MAPK pathways to induce inflammation, promote apoptotic cell death, inhibit tumorigenesis, and inhibit viral replication. |
Bio-activity : | Neutralization of human TNF alpha induced L929 cell cytolysis, ≤100 ng/mL |
Molecular Mass : | Monomer, 18.3 kDa (162 aa) |
AA Sequence : | MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | TNFRSF1A tumor necrosis factor receptor superfamily, member 1A [ Homo sapiens (human) ] |
Official Symbol | TNFRSF1A |
Synonyms | TNFRSF1A; tumor necrosis factor receptor superfamily, member 1A; TNFR1; tumor necrosis factor receptor superfamily member 1A; CD120a; TNF R; TNF R I; TNF R55; TNFAR; TNFR60; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; FPF; p55; p60; TBP1; TNF-R; p55-R; TNFR55; TNF-R-I; TNF-R55; MGC19588; |
Gene ID | 7132 |
mRNA Refseq | NM_001065 |
Protein Refseq | NP_001056 |
MIM | 191190 |
UniProt ID | P19438 |
◆ Recombinant Proteins | ||
TNFRSF1A-46H | Recombinant Human TNFRSF1A protein, hIgG-His-tagged | +Inquiry |
TNFRSF1A-5535H | Recombinant Human TNFRSF1A protein, His-tagged | +Inquiry |
TNFRSF1A-152H | Active Recombinant Human TNFRSF1A, Fc Chimera | +Inquiry |
TNFRSF1A-1577H | Recombinant Human Tumor Necrosis Factor Receptor Superfamily, Member 1A | +Inquiry |
TNFRSF1A-4634H | Recombinant Human TNFRSF1A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-2390HCL | Recombinant Human TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF1A Products
Required fields are marked with *
My Review for All TNFRSF1A Products
Required fields are marked with *
0
Inquiry Basket