Active Recombinant Human TGFB2 Protein

• Cat.No.: TGFB2-016H
• Product Overview: Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 2, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016].
• Bio-activity: Determined by its ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. ED50 was found to be < 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
• Molecular Mass: 25 kDa
• AA Sequence: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2

Gene Information

• Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
• Official Symbol: TGFB2
• Synonyms: TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892
• Gene ID: 7042
• mRNA Refseq: NM_001135599
• Protein Refseq: NP_001129071
• MIM: 190220
• UniProt ID: P61812