Active Recombinant Human ST6GAL1 Protein (AA 75-406), N-6×His/GFP tagged

Cat.No. : ST6GAL1-14H
Product Overview : Recombinant Human ST6GAL1 Protein (AA 75-406) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 75-406
Description : This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
Bio-activity : ≥0.5 μmol/min/mg
Molecular Mass : ~60-70 kDa
AA Sequence : RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [ Homo sapiens (human) ]
Official Symbol ST6GAL1
Synonyms ST6GAL1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; sialyltransferase 1 (beta galactoside alpha 2,6 sialytransferase) , SIAT1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6Gal I; alpha 2,6-ST 1; B-cell antigen CD75; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6N; SIAT1; ST6GalI; MGC48859;
Gene ID 6480
mRNA Refseq NM_173216
Protein Refseq NP_775323
MIM 109675
UniProt ID P15907

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ST6GAL1 Products

Required fields are marked with *

My Review for All ST6GAL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon