Active Recombinant Human ST6GAL1 Protein (AA 75-406), N-6×His/GFP tagged

Description :	This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
Source :	HEK293
Species :	Human
Tag :	His&GFP
Bio-activity :	≥0.5 μmol/min/mg
Molecular Mass :	~60-70 kDa
Protein length :	AA 75-406
AA Sequence :	RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Purity :	>95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability :	6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration :	1 mg/mL
Storage Buffer :	Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative :	0.05 % NaN3
Shipping :	This product is shipped as 0.2μm filtered product on dry ice.

Gene Name	ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [ Homo sapiens (human) ]
Official Symbol	ST6GAL1
Synonyms	ST6GAL1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; sialyltransferase 1 (beta galactoside alpha 2,6 sialytransferase) , SIAT1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6Gal I; alpha 2,6-ST 1; B-cell antigen CD75; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6N; SIAT1; ST6GalI; MGC48859;
Gene ID	6480
mRNA Refseq	NM_173216
Protein Refseq	NP_775323
MIM	109675
UniProt ID	P15907