Active Recombinant Human ST6GAL1 Protein (75-406), N-6×His and GFP tagged

Description :	This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
Source :	HEK293
Species :	Human
Tag :	His&GFP
Bio-activity :	≥0.5 μmol/min/mg
Molecular Mass :	~60-70 kDa
Protein length :	75-406
AA Sequence :	RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Purity :	>95%, by SDS_PAGE under reducing conditions and visualized by Coomassie Blue stain
Storage :	6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Storage Buffer :	Supplied as a 0.2 μm filtered soulution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol and 0.05 % NaN3 as preservative.
Shipping :	This product is shipped as 0.2 μm filtered product on dry ice. Upon receipt, store it immediately at the temperature recommended below.

Gene Name	ST6GAL1 ST6 beta-galactoside alpha-2,6-sialyltransferase 1 [ Homo sapiens (human) ]
Official Symbol	ST6GAL1
Synonyms	ST6GAL1; ST6 beta-galactoside alpha-2,6-sialyltransferase 1; ST6N; CDw75; SIAT1; ST6GalI; beta-galactoside alpha-2,6-sialyltransferase 1; B-cell antigen CD75; CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; alpha 2,6-ST 1; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); EC 2.4.3.1
Gene ID	6480
mRNA Refseq	NM_173216
Protein Refseq	NP_775323
MIM	109675
UniProt ID	P15907

COA

Cat.No. :	ST6GAL1-11H
Product Overview :	Recombinant Human CMP-N-acetylneuraminate beta-galactosamide-alpha-2,6-sialyltransferase (ST6GAL1) with a N-6×His, GFP tag was expressed in HEK293.