Active Recombinant Human ST6GAL1 Protein (75-406), N-6×His and GFP tagged

• Cat.No.: ST6GAL1-11H
• Product Overview: Recombinant Human CMP-N-acetylneuraminate beta-galactosamide-alpha-2,6-sialyltransferase (ST6GAL1) with a N-6×His, GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: 75-406
• Description: This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
• Bio-activity: ≥0.5 μmol/min/mg
• Molecular Mass: ~60-70 kDa
• AA Sequence: RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
• Purity: >95%, by SDS_PAGE under reducing conditions and visualized by Coomassie Blue stain
• Storage: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Storage Buffer: Supplied as a 0.2 μm filtered soulution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol and 0.05 % NaN3 as preservative.
• Shipping: This product is shipped as 0.2 μm filtered product on dry ice. Upon receipt, store it immediately at the temperature recommended below.

Gene Information

• Gene Name: ST6GAL1 ST6 beta-galactoside alpha-2,6-sialyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: ST6GAL1
• Synonyms: ST6GAL1; ST6 beta-galactoside alpha-2,6-sialyltransferase 1; ST6N; CDw75; SIAT1; ST6GalI; beta-galactoside alpha-2,6-sialyltransferase 1; B-cell antigen CD75; CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; alpha 2,6-ST 1; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); EC 2.4.3.1
• Gene ID: 6480
• mRNA Refseq: NM_173216
• Protein Refseq: NP_775323
• MIM: 109675
• UniProt ID: P15907