Active Recombinant Human SLAMF1, Fc-tagged, Biotinylated
Cat.No. : | SLAMF1-678H |
Product Overview : | The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 - Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-237 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Co-stimulates IL-4 secretion by T cells in the presence of anti-CD3e antibody |
Molecular Mass : | Calculated molecular mass (kDa): 49.9; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
AA Sequence : | ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDR YKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKG DHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPSTGTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | SLAMF1 signaling lymphocytic activation molecule family member 1 [ Homo sapiens ] |
Official Symbol | SLAMF1 |
Synonyms | SLAMF1; signaling lymphocytic activation molecule family member 1; signaling lymphocytic activation molecule , SLAM; signaling lymphocytic activation molecule; CD150; IPO-3; SLAM; CDw150; |
Gene ID | 6504 |
mRNA Refseq | NM_003037 |
Protein Refseq | NP_003028 |
MIM | 603492 |
UniProt ID | Q13291 |
Chromosome Location | 1q23.3 |
Pathway | Measles, organism-specific biosystem; Measles, conserved biosystem; |
Function | antigen binding; receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
SLAMF1-351H | Recombinant Human SLAMF1 protein, His-tagged | +Inquiry |
Slamf1-6806M | Recombinant Mouse Slamf1 Protein (Thr25-Pro242), C-His tagged | +Inquiry |
Slamf1-7102R | Recombinant Rat Slamf1 protein, His & T7-tagged | +Inquiry |
SLAMF1-680H | Recombinant Human SLAMF1 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
SLAMF1-1583R | Recombinant Rhesus Monkey SLAMF1 Protein, hIgG1-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF1-2760HCL | Recombinant Human SLAMF1 cell lysate | +Inquiry |
SLAMF1-1004RCL | Recombinant Rat SLAMF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLAMF1 Products
Required fields are marked with *
My Review for All SLAMF1 Products
Required fields are marked with *
0
Inquiry Basket