Active Recombinant Human SLAMF1, Fc-tagged, Biotinylated

• Cat.No.: SLAMF1-678H
• Product Overview: The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 - Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Co-stimulates IL-4 secretion by T cells in the presence of anti-CD3e antibody
• Molecular Mass: Calculated molecular mass (kDa): 49.9; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
• AA Sequence: ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDR YKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKG DHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPSTGTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 21-237 a.a.

Gene Information

• Gene Name: SLAMF1 signaling lymphocytic activation molecule family member 1 [ Homo sapiens ]
• Official Symbol: SLAMF1
• Synonyms: SLAMF1; signaling lymphocytic activation molecule family member 1; signaling lymphocytic activation molecule , SLAM; signaling lymphocytic activation molecule; CD150; IPO-3; SLAM; CDw150
• Gene ID: 6504
• mRNA Refseq: NM_003037
• Protein Refseq: NP_003028
• MIM: 603492
• UniProt ID: Q13291
• Chromosome Location: 1q23.3
• Pathway: Measles, organism-specific biosystem; Measles, conserved biosystem
• Function: antigen binding; receptor activity; transmembrane signaling receptor activity