Active Recombinant Human PVR, Fc-tagged, Biotinylated
Cat.No. : | PVR-652H |
Product Overview : | The recombinant human NECL5-Fc fusion protein is expressed as a 552-amino acid protein consisting of Trp21 - Asn343 region of NECL5 (UniProt accession #15151 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-343 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized NECL5 interacts with CD226 in a functional ELISA |
Molecular Mass : | Calculated molecular mass (kDa): 60.7; Estimated by SDS-PAGE under reducing condition (kDa): 75-85 |
AA Sequence : | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEF VAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVS TGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYY PPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTN ALGARQAELTVQVKEGPPSEHSGISRNGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | PVR poliovirus receptor [ Homo sapiens ] |
Official Symbol | PVR |
Synonyms | PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946; |
Gene ID | 5817 |
mRNA Refseq | NM_001135768 |
Protein Refseq | NP_001129240 |
MIM | 173850 |
UniProt ID | P15151 |
Chromosome Location | 19q13.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | cell adhesion molecule binding; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
PVR-3325RAF555 | Recombinant Rat PVR Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PVR-2645H | Recombinant Human PVR Protein, His-tagged | +Inquiry |
PVR-624C | Recombinant Rhesus PVR protein, His-tagged | +Inquiry |
PVR-051H | Active Recombinant Human PVR protein, Fc-tagged, Biotinylated | +Inquiry |
PVR-013H | Recombinant Human CD155 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVR-2456HCL | Recombinant Human PVR cell lysate | +Inquiry |
PVR-2270CCL | Recombinant Cynomolgus PVR cell lysate | +Inquiry |
PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PVR Products
Required fields are marked with *
My Review for All PVR Products
Required fields are marked with *
0
Inquiry Basket