Active Recombinant Human PRL Protein

• Cat.No.: PRL-228H
• Product Overview: Recombinant Human PRL Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Prolactin is a hormone that is produced and secreted by the pituitary gland. Prolactin acts in an endocrine, paracrine, and autocrine manner. The prolactin receptor (PRLR) is expressed on many cell types, including cells of the reproductive organs, central nervous system, and breast cancer. Prolactin signal transduction occurs via JAK kinase signaling pathways. The primary function of prolactin is to regulate lactation, but prolactin also plays functional roles in the immune system and during cell growth, apoptosis, and differentiation.
• Bio-activity: NB2-11 cell proliferation, ≤1 ng/mL
• Molecular Mass: Monomer, 23 kDa (200 aa)
• AA Sequence: MLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: PRL prolactin [ Homo sapiens (human) ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin; decidual prolactin
• Gene ID: 5617
• mRNA Refseq: NM_000948
• Protein Refseq: NP_000939
• MIM: 176760
• UniProt ID: P01236