Active Recombinant Human PPBP Protein (70 aa)

• Cat.No.: PPBP-215P
• Product Overview: Recombinant human NAP-2/CXCL7 produced in CHO cells is a single polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhNAP-2/CXCL7 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: CHO
• Protein Length: 70
• Description: Chemokine (C-X-C motif) ligand(CXCL7) is a small cytokine belonging to the CXC chemokine family. It is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein (PPBP). CXCL7can signal through the CXCR1 and CXCR2 receptors. It is a protein that is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of human NAP-2/CXCL7 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCXCR1 cells (human Ga15 and human CXCR1 stably expressed in CHO-K1 cells) is less than 0.1 μg/mL.
• Molecular Mass: 9 kDa, observed by reducing SDS-PAGE.
• AA Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant humanNAP-2/CXCL7 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human NAP-2/CXCL7 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: PPBP pro-platelet basic protein [ Homo sapiens (human) ]
• Official Symbol: PPBP
• Synonyms: PPBP; pro-platelet basic protein; PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; platelet basic protein; C-X-C motif chemokine 7; CXC chemokine ligand 7; beta-thromboglobulin; chemokine (C-X-C motif) ligand 7; connective tissue-activating peptide III; leukocyte-derived growth factor; low-affinity platelet factor IV; macrophage-derived growth factor; neutrophil-activating peptide 2; small inducible cytokine B7; small inducible cytokine subfamily B, member 7; thrombocidin 1; thrombocidin 2; thromboglobulin, beta-1
• Gene ID: 5473
• mRNA Refseq: NM_002704
• Protein Refseq: NP_002695
• MIM: 121010
• UniProt ID: P02775