Active Recombinant Human PDGFDD Protein

• Cat.No.: PDGFD-209P
• Product Overview: Recombinant Human PDGFDD Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 μg/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 19-21 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: PDGFD platelet derived growth factor D [ Homo sapiens ]
• Official Symbol: PDGFD
• Synonyms: PDGFD; platelet derived growth factor D; platelet-derived growth factor D; IEGF; MSTP036; SCDGF B; spinal cord derived growth factor B; PDGF-D; iris-expressed growth factor; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; SCDGFB; SCDGF-B; MGC26867
• Gene ID: 80310
• mRNA Refseq: NM_025208
• Protein Refseq: NP_079484
• MIM: 609673
• UniProt ID: Q9GZP0