Active Recombinant Human PDGFDD Protein

Description :	PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.
Source :	CHO
Species :	Human
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 5 μg/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass :	19-21 kDa, observed by reducing SDS-PAGE.
AA Sequence :	SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE.
Storage :	Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	PDGFD platelet derived growth factor D [ Homo sapiens ]
Official Symbol	PDGFD
Synonyms	PDGFD; platelet derived growth factor D; platelet-derived growth factor D; IEGF; MSTP036; SCDGF B; spinal cord derived growth factor B; PDGF-D; iris-expressed growth factor; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; SCDGFB; SCDGF-B; MGC26867;
Gene ID	80310
mRNA Refseq	NM_025208
Protein Refseq	NP_079484
MIM	609673
UniProt ID	Q9GZP0