Active Recombinant Human PAK7

• Cat.No.: PAK7-20H
• Product Overview: PAK7KD (PAK5KD) is a recombinant wild type human PAK7 kinase domain (amino acids 425–719 of full-length human PAK7) expressed in E. coli and purified to homogeneity with full activity.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Human PAK7 kinase (UniProt: Q9P286; NCBI: NM_177990) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK7 (PAK5) is predominantly expressed in brain. It is capable of promoting neurite outgrowth and cell survival.
• Form: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
• Bio-activity: 4,199 pmoles/min/μg
• Molecular Mass: The calculated mass is 33,934. PAK7KD is fully phosphorylated at S602 and an additional site with a measured mass of 34,096 (2P).
• AA Sequence: GPHPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEV VIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLHNQGVIHRDI KSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPY FNEPPLQAIRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYR HH
• Applications: Enzymatic studies, inhibitor screen, and selectivity profiling
• Storage: Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.

Gene Information

• Gene Name: PAK7 p21 protein (Cdc42/Rac)-activated kinase 7 [ Homo sapiens ]
• Official Symbol: PAK7
• Synonyms: PAK7; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A) activated kinase 7; serine/threonine-protein kinase PAK 7; KIAA1264; PAK5; PAK-5; PAK-7; protein kinase PAK5; p21-activated kinase 5; p21-activated kinase 7; p21CDKN1A-activated kinase 7; p21(CDKN1A)-activated kinase 7; serine/threonine-protein kinase PAK7; MGC26232
• Gene ID: 57144
• mRNA Refseq: NM_020341
• Protein Refseq: NP_065074
• MIM: 608038
• UniProt ID: Q9P286
• Chromosome Location: 20p12
• Pathway: Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem
• Function: ATP binding; nucleotide binding; protein serine/threonine kinase activity