Active Recombinant Human PAK7
Cat.No. : | PAK7-20H |
Product Overview : | PAK7KD (PAK5KD) is a recombinant wild type human PAK7 kinase domain (amino acids 425–719 of full-length human PAK7) expressed in E. coli and purified to homogeneity with full activity. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Human PAK7 kinase (UniProt: Q9P286; NCBI: NM_177990) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK7 (PAK5) is predominantly expressed in brain. It is capable of promoting neurite outgrowth and cell survival. |
Form : | 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT. |
Bio-activity : | 4,199 pmoles/min/μg |
Molecular Mass : | The calculated mass is 33,934. PAK7KD is fully phosphorylated at S602 and an additional site with a measured mass of 34,096 (2P). |
AA Sequence : | GPHPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEV VIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLHNQGVIHRDI KSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPY FNEPPLQAIRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYR HH |
Applications : | Enzymatic studies, inhibitor screen, and selectivity profiling |
Storage : | Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC. |
Gene Name | PAK7 p21 protein (Cdc42/Rac)-activated kinase 7 [ Homo sapiens ] |
Official Symbol | PAK7 |
Synonyms | PAK7; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A) activated kinase 7; serine/threonine-protein kinase PAK 7; KIAA1264; PAK5; PAK-5; PAK-7; protein kinase PAK5; p21-activated kinase 5; p21-activated kinase 7; p21CDKN1A-activated kinase 7; p21(CDKN1A)-activated kinase 7; serine/threonine-protein kinase PAK7; MGC26232; |
Gene ID | 57144 |
mRNA Refseq | NM_020341 |
Protein Refseq | NP_065074 |
MIM | 608038 |
UniProt ID | Q9P286 |
Chromosome Location | 20p12 |
Pathway | Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; |
Function | ATP binding; nucleotide binding; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
PAK7-1515H | Recombinant Human PAK7, GST-tagged | +Inquiry |
PAK7-3924R | Recombinant Rat PAK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAK7-12211Z | Recombinant Zebrafish PAK7 | +Inquiry |
PAK7-725H | Recombinant Human PAK7, GST-His | +Inquiry |
PAK7-522H | Recombinant Human P21 Protein (Cdc42/Rac)-Activated Kinase 7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK7-3453HCL | Recombinant Human PAK7 293 Cell Lysate | +Inquiry |
PAK7-3452HCL | Recombinant Human PAK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAK7 Products
Required fields are marked with *
My Review for All PAK7 Products
Required fields are marked with *
0
Inquiry Basket