Active Recombinant Human NOG Protein
| Cat.No. : | NOG-001H |
| Product Overview : | Recombinant Human Noggin consisting of two 205 amino acid polypeptide chains without tag was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | HEK293 |
| Species : | Human |
| Bio-activity : | Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 2.0-3.0 ng/ml of Noggin. |
| Molecular Mass : | 46 kDa |
| AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Purity : | ≥ 95% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | NOG noggin [ Homo sapiens (human) ] |
| Official Symbol | NOG |
| Synonyms | NOG; noggin; SYM1; SYNS1; SYNS1A; |
| Gene ID | 9241 |
| mRNA Refseq | NM_005450 |
| Protein Refseq | NP_005441 |
| MIM | 602991 |
| UniProt ID | Q13253 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
0
Inquiry Basket
