Active Recombinant Human NOG Protein

Cat.No. : NOG-001H
Product Overview : Recombinant Human Noggin consisting of two 205 amino acid polypeptide chains without tag was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Bio-activity : Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 2.0-3.0 ng/ml of Noggin.
Molecular Mass : 46 kDa
AA Sequence : QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Purity : ≥ 95% by SDS-PAGE gel and HPLC analyses.
Gene Name NOG noggin [ Homo sapiens (human) ]
Official Symbol NOG
Synonyms NOG; noggin; SYM1; SYNS1; SYNS1A;
Gene ID 9241
mRNA Refseq NM_005450
Protein Refseq NP_005441
MIM 602991
UniProt ID Q13253

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOG Products

Required fields are marked with *

My Review for All NOG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon