Active Recombinant Human MSLN, His-tagged, Biotinylated

• Cat.No.: MSLN-642H
• Product Overview: The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 - Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 296-592 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 with high affinity KD< 5 nM as measured by ELISA.
• Molecular Mass: Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50
• AA Sequence: EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQ HLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSL SPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSM DLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS TTENLYFQGSTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >90% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: MSLN mesothelin [ Homo sapiens ]
• Official Symbol: MSLN
• Synonyms: MSLN; mesothelin; CAK1; MPF; CAK1 antigen; megakaryocyte potentiating factor; soluble MPF mesothelin related protein; pre-pro-megakaryocyte-potentiating factor; SMRP
• Gene ID: 10232
• mRNA Refseq: NM_001177355
• Protein Refseq: NP_001170826
• MIM: 601051
• UniProt ID: Q13421
• Chromosome Location: 16p13.3