Active Recombinant Human LY9, Fc-tagged
Cat.No. : | LY9-682H |
Product Overview : | The recombinant human SLAMF3-Fc fusion protein is expressed as a 540-amino acid protein consisting of Lys48 - Arg359 region of SLAMF3 (UniProt accession #Q9HBG7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 48-359 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized SLAMF3 binds homophilically to biotinylated SLAMF3 in a functional ELISA |
Molecular Mass : | Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 75-85 |
AA Sequence : | KDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNL TLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPRE PHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPL ALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEA SSVTSMTHVTLLIYRRSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | LY9 lymphocyte antigen 9 [ Homo sapiens ] |
Official Symbol | LY9 |
Synonyms | LY9; lymphocyte antigen 9; T-lymphocyte surface antigen Ly-9; CD229; hly9; mLY9; SLAMF3; cell surface molecule Ly-9; cell-surface molecule Ly-9; |
Gene ID | 4063 |
mRNA Refseq | NM_001033667 |
Protein Refseq | NP_001028839 |
MIM | 600684 |
UniProt ID | Q9HBG7 |
Chromosome Location | 1q23.3 |
Function | molecular_function; receptor activity; |
◆ Recombinant Proteins | ||
LY9-4565H | Recombinant Human LY9 Protein, GST-tagged | +Inquiry |
LY9-485H | Recombinant Human LY9 | +Inquiry |
LY9-1791H | Recombinant Human LY9 protein, His-tagged | +Inquiry |
LY9-3410H | Recombinant Human LY9 Protein, His (Fc)-Avi-tagged | +Inquiry |
LY9-1421H | Recombinant Human LY9 Protein (Met161-Arg358), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY9-2112MCL | Recombinant Mouse LY9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY9 Products
Required fields are marked with *
My Review for All LY9 Products
Required fields are marked with *
0
Inquiry Basket