Active Recombinant Human LILRB1 Protein, His-tagged
Cat.No. : | LILRB1-028H |
Product Overview : | Recombinant human LILRB1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Description : | This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Bio-activity : | Measured by the ability of the immobilized protein to support the adhesion of HSB2 human peripheral blood acute lymphoblastic leukemia cells. When cells are added to LILRB1 coated plates 5μg/mL. This effect is more to 50%. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHTGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -107 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | LILRB1 leukocyte immunoglobulin like receptor B1 [ Homo sapiens (human) ] |
Official Symbol | LILRB1 |
Synonyms | LILRB1; leukocyte immunoglobulin like receptor B1; ILT2; LIR1; MIR7; PIRB; CD85J; ILT-2; LIR-1; MIR-7; PIR-B; leukocyte immunoglobulin-like receptor subfamily B member 1; CD85 antigen-like family member J; Ig-like transcript 2; leucocyte Ig-like receptor B1; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1; monocyte/macrophage immunoglobulin-like receptor 7; myeloid inhibitory receptor 7 |
Gene ID | 10859 |
mRNA Refseq | NM_006669 |
Protein Refseq | NP_006660 |
MIM | 604811 |
UniProt ID | Q8NHL6 |
◆ Recombinant Proteins | ||
LILRB1-087H | Recombinant Human LILRB1 protein, His-Avi-tagged | +Inquiry |
LILRB1-1722R | Recombinant Rhesus macaque LILRB1 protein, His-tagged | +Inquiry |
LILRB1-3935H | Recombinant Human LILRB1 Protein (Met1-Val461), C-His tagged | +Inquiry |
LILRB1-110H | Recombinant Human LILRB1 protein, Fc-tagged | +Inquiry |
LILRB1-5052H | Recombinant Human LILRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB1-774HCL | Recombinant Human LILRB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRB1 Products
Required fields are marked with *
My Review for All LILRB1 Products
Required fields are marked with *
0
Inquiry Basket