Active Recombinant Human KLK11 Protein (232 aa)

Cat.No. : KLK11-140K
Product Overview : Recombinant human Kallikrein-11(rhKLK-11) secreted in Sf9 insect cells is a single glycosylated polypeptide chain containing 232 amino acids. A fully biologically active molecule, rhKallikrein-11 has a molecular mass of 35.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Sf9 Cells
Protein Length : 232
Description : Kallikreins are a subgroup of serine proteases having diverse physiological functions. Kallikrein-11 (KLK-11) is possible multifunctional protease.KLK11 efficiently cleaves 'bz-Phe-Arg-4-methylcoumaryl-7-amide', a kallikrein substrate, and weakly cleaves other substrates for kallikrein and trypsin. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : KLK-11 specific activity is > 2000 pmole/min/μg when measured by 100uM colormetric peptide substrate (D-Val-Leu-Lys-ThioBenzyl ester).
Molecular Mass : 35.0 kDa, observed by reducing SDS-PAGE.
AA Sequence : EFAATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAHHHHHHGSGSDDDDKETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Kallikrein-11(rhKLK-11) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhKLK-11 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS, pH7.4
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name KLK11 kallikrein-related peptidase 11 [ Homo sapiens ]
Official Symbol KLK11
Synonyms KLK11; kallikrein-related peptidase 11; kallikrein 11, PRSS20; kallikrein-11; TLSP; hK11; hippostasin; kallikrein 11; serine protease 20; trypsin-like protease; PRSS20; MGC33060;
Gene ID 11012
mRNA Refseq NM_001136032
Protein Refseq NP_001129504
MIM 604434
UniProt ID Q9UBX7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KLK11 Products

Required fields are marked with *

My Review for All KLK11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon