Active Recombinant Human KLK11 Protein (232 aa)
Cat.No. : | KLK11-140K |
Product Overview : | Recombinant human Kallikrein-11(rhKLK-11) secreted in Sf9 insect cells is a single glycosylated polypeptide chain containing 232 amino acids. A fully biologically active molecule, rhKallikrein-11 has a molecular mass of 35.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Sf9 Cells |
Protein Length : | 232 |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Kallikrein-11 (KLK-11) is possible multifunctional protease.KLK11 efficiently cleaves 'bz-Phe-Arg-4-methylcoumaryl-7-amide', a kallikrein substrate, and weakly cleaves other substrates for kallikrein and trypsin. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | KLK-11 specific activity is > 2000 pmole/min/μg when measured by 100uM colormetric peptide substrate (D-Val-Leu-Lys-ThioBenzyl ester). |
Molecular Mass : | 35.0 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | EFAATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAHHHHHHGSGSDDDDKETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Kallikrein-11(rhKLK-11) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhKLK-11 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS, pH7.4 |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | KLK11 kallikrein-related peptidase 11 [ Homo sapiens ] |
Official Symbol | KLK11 |
Synonyms | KLK11; kallikrein-related peptidase 11; kallikrein 11, PRSS20; kallikrein-11; TLSP; hK11; hippostasin; kallikrein 11; serine protease 20; trypsin-like protease; PRSS20; MGC33060; |
Gene ID | 11012 |
mRNA Refseq | NM_001136032 |
Protein Refseq | NP_001129504 |
MIM | 604434 |
UniProt ID | Q9UBX7 |
◆ Recombinant Proteins | ||
KLK11-075H | Recombinant Human KLK11 Protein, His-tagged | +Inquiry |
KLK11-753H | Recombinant Human KLK11 protein, His & T7-tagged | +Inquiry |
Klk11-3724M | Recombinant Mouse Klk11 Protein, Myc/DDK-tagged | +Inquiry |
KLK11-2672H | Active Recombinant Human KLK11 protein, His-tagged | +Inquiry |
KLK11-858H | Recombinant Human KLK11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK11-1551MCL | Recombinant Mouse KLK11 cell lysate | +Inquiry |
KLK11-2680HCL | Recombinant Human KLK11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLK11 Products
Required fields are marked with *
My Review for All KLK11 Products
Required fields are marked with *
0
Inquiry Basket