Active Recombinant Human KITLG Protein
Cat.No. : | KITLG-199H |
Product Overview : | Recombinant Human KITLG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Stem cell factor (SCF) is a cytokine made by fibroblasts and endothelial cells. SCF binds to the receptor c-Kit/CD117 and plays a critical role in the maintenance, survival, and differentiation of hematopoietic stem cells. While human SCF shows no activity on murine cells, murine and rat SCF are active on human cells. |
Bio-activity : | TF-1 cell proliferation, ≤15 ng/mL; ≥6.7 x 10^4 units/mg |
Molecular Mass : | Monomer, 18.6 kDa (165 aa) |
AA Sequence : | MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5. |
Reconstitution : | Sterile water at 0.1 mg/mL. |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | KITLG KIT ligand [ Homo sapiens (human) ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
Gene ID | 4254 |
mRNA Refseq | NM_000899 |
Protein Refseq | NP_000890 |
MIM | 184745 |
UniProt ID | P21583 |
◆ Recombinant Proteins | ||
Kitlg-34M | Active Recombinant Mouse Kitlg, His-tagged | +Inquiry |
Kitlg-200R | Recombinant Rat Kitlg Protein | +Inquiry |
Kitl-61M | Recombinant Mouse Kit Ligand | +Inquiry |
KITLG-829M | Recombinant Mouse KITLG Protein (Met1-Ala189), His-tagged, Biotinylated | +Inquiry |
KITL-154M | Recombinant Mouse KITL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
0
Inquiry Basket