Active Recombinant Human IL25 Protein, His-tagged

• Cat.No.: IL25-11H
• Product Overview: Recombinant human IL-17E/IL-25 (33-177 aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 154
• Description: The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human IL-17 RB.
• Molecular Mass: 17.8 kDa
• AA Sequence: YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol

Gene Information

• Gene Name: IL25 interleukin 25 [ Homo sapiens (human) ]
• Official Symbol: IL25
• Synonyms: IL25; interleukin 25; IL17E; interleukin-25; interleukin-17E
• Gene ID: 64806
• mRNA Refseq: NM_022789
• Protein Refseq: NP_073626
• MIM: 605658
• UniProt ID: Q9H293